SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma14g38490.1|PACid:16296832 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g38490.1|PACid:16296832
Domain Number 1 Region: 214-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000419
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma14g38490.1|PACid:16296832
Sequence length 586
Sequence
MESSRLVSFNVLLQIRDTKNTIGSVRSIKNNARNRHTEHIDGRLLVDSAGKGNLMLLRRD
VEASESIRWPRAERDGIDSCIGPNRQEDRRFSNVVKLSGHSLNFTTLDHNRPTWETQTMH
KSSSLNMSLGTSSGNSVQPSALDIAERRLEDKASFCPFPQGQRSLSISKSLMDGITMNLE
DSKGVISQERVARPPANGKPKNLLHFRYWPRITVPLFEKVLSASDAGRIGRLVLPKSCAE
SEGLPLQFKDVKGNDWTFQFRFWPNNNSRMYVLEGVTPCIQAMQLNAVTFSRIDPGGKFV
MGYRRASDSMDTQVEATFSGATANLHSGKSYPDLLQTRNGNGEPYLNGCSEHLRFGTGTA
DCLQTENCEMVNNDLLQQTISVSEKTLNIAPKSKRLLTHNEDAVELRITWEEAQDLLHPP
PSTMPSVETIEDKEFEEFEEPPVFGKGTTINDPPSGSLSSASEKMSSMDLENIPVTSKDS
KKRRIMEKLDSSAGATTKHPRHCSGCTCILCIQPPSGKGRHKPTCTTVRRQFKTLMKRKK
QRESDATQNDQIHHSDEGDTHGASREGAIASNLENEGSLNRMDELX
Download sequence
Identical sequences Glyma14g38490.1|PACid:16296832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]