SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma14g40540.1|PACid:16297069 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g40540.1|PACid:16297069
Domain Number 1 Region: 136-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-46
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 812-889
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000814
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma14g40540.1|PACid:16297069
Sequence length 916
Sequence
MASVEEKIKTGGGMIVGGQTLAAEMKLLKEMQEHSGVRKTLNSELWHACAGPLVSLPQVG
SLVFYFPQGHSEQVAASTRRTATSQIPNYPNLPYQLLCQVQNVTLHADKETDEIYAQMTL
QPLNSEREVFPISDFGHKHSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYTI
QPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDERSQ
LRVGVRRVNRQQTTLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYNPRACPSEFVIPL
AKYRKSVFGTQVSVGMRFGMMFETEESGKRRYMGTIVGISDVDPLRWPGSKWRNIQVEWD
EPGCGDKQNRVSVWEIETPESLFIFPSLTSGLKRPLPSGLLENEWGTLLRRPFIRVPENG
TMELSNSIPNLYSEHMMRMLLKPQLINNNGAFLSAMQQESAATRGPLQEMKTTLAAENQM
PLKNLHPHSIPDQPNALNMQSLLKNDQPEKLHPLGKIDNHLSSGIVIDKPKSESEVLPDH
VIDYPSMEGCNIEKVAANPVNQQGLANQLPFHNQNQSPLLPQSSPWPMPPQIELSMPHPQ
MIDMVQADSAMVNGLFPQLDINEWMSYASSQPFAGQNRPTGPLSDLQEHTSLQPQVVNPP
LPSMNNEVWDHYVKNLKFLSQADQLTSICQPGLYGLNGIPSSNNLRDLSAESNNQSTTVV
DPSTSSTILDEFCTMKDREFQNPQDCMVGNLSSSQDVQSQITSASLTESHAFPLRDIPDN
SGGTSSSHVDFDESSFLQNNSWQQVPAPIRTYTKVQKAGSVGRSIDVTTFKNYEELIRAI
ECMFGLDGLLNDTKCSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPSEVQQMSE
EGMKLLNSGALQGMNV
Download sequence
Identical sequences Glyma14g40540.1|PACid:16297069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]