SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma15g09750.1|PACid:16298234 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma15g09750.1|PACid:16298234
Domain Number 1 Region: 112-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.76e-47
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 767-842
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000981
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma15g09750.1|PACid:16298234
Sequence length 900
Sequence
MRLSSADFSPPPQEGEKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKE
VDAHIPNYPSLPPQLICQLHNMTMHADVETDEVYAQMTLQPLNPQEQNEAYLPAELGTAS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWQAMNEKNQLLLGIRRANRPQTVMPS
SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR
FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
PLTTFPMYPSSFPLRLKRPWPPGLPSFHGMKDDDFGLNSPLLWLRDTDRGLQSLNFQGIG
VNPWMQPRFDPTVLNMQTDMYQAAAAAAVQDMRSLDPSKQLSASLLQFQQPQNFPNRTAA
LMQAQMLQKSQPQQIFGNNQENQHSPQSQPQTQAHLQQHLQHQHSFNSQHHHHQQQQQQQ
QVVDNQQISSAVSTMSQLFSAPQPQSPPMQAISSLCQNFSNSNGNSVTTIVSPLHSILGS
FPQDETSHLLNLPRTSSWIPIQNSSGWPSKRVAVDPLLSSGASHCVLPQVDQLGQPHSTM
SLNAITLPPFPGRESSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSSLKGVSGNNNSST
LPYQSSNYLNTTTGTDSSLNHGMTPNIGDSGFLHCPEDAGQGNPLNKTFVKVYKSGSFGR
SLDITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNS
VWCIKILSPQEVQQMGNNGLELLNSVPNQRLSNGICDDYVSRQDPRNLSTGITTVGSLDY
Download sequence
Identical sequences Glyma15g09750.1|PACid:16298234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]