SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma16g00220.1|PACid:16300944 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma16g00220.1|PACid:16300944
Domain Number 1 Region: 109-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-41
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 540-615
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000181
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma16g00220.1|PACid:16300944
Sequence length 662
Sequence
MASAAPGATNDALYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASMNQGLEQQMPS
FNLPSKILCKVVNVHLRAEPETDEVYAQITLLPEADQSEVTSPDDPLPESPRCTVHSFCK
TLTASDTSTHGGFSVLRRHADDCLPPLDMTQQPPWQELVATDLHGNEWHFRHIFRGQPRR
HLLTTGWSVFVSSKKLVAGDAFIFLRQARQMIVVLFFLRLMRQHSNMPSSVISSHSMHLG
VLATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPE
RRFSGTIVGVEDNKSLVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSNPPTNSQP
SQRNKRSRPPILPSTMLDSSLQGGLGIPNFSIKLCMEITNVYPSTNFNSTATGFLGFGGN
CSASNKSIYWSSRIENSTESFSPVAVKEFGEKRQGTANGCRLFGIQLHDNSNSNEESLPM
VSLSGRVGDDGLLPSLDAESDQHSEPSNVNRSDFPSVSCDAEKSCLRSPQESQSRQIRSC
TKVHMQGMAVGRAVDLTRFDGYEDLLRKLEEMFDINGELCGSTKEWQVVYTDNEDDMMMV
GDDPWLEFCSIVRKIFIYTAEEVKKLSPKIGLPISEEVKPCKMDSEAVVNPGDQSSILGP
GC
Download sequence
Identical sequences Glyma16g00220.1|PACid:16300944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]