SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma16g02650.1|PACid:16301238 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma16g02650.1|PACid:16301238
Domain Number 1 Region: 101-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-41
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 559-639
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000206
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma16g02650.1|PACid:16301238
Sequence length 683
Sequence
MGLKDDDLYRELWKLCAGPLVDVPRTGDRVFYFPQGHMEQLQASTDQELNQEIPHFNLPA
KIFCRVVNIQLLAEQDTDEVYACIALLPESDQTEPTNPDPNISEPPKQKFHSFCKILTAS
DTSTHGGFSVLRKHATECLPALDMTQATPTQELAAKDLHGFEWKFKHIYRGQPRRHLLTT
GWSTFVASKRLVAGDAFVFLRGEHGQLRVGVRRLARQQSPMPSSVISSQSMHLGVLATAS
HAVMTRTMFLVYYKPRTSQFIVGLNKYLEAVNNKFSLGMRFKMRFEGDDSPERRYSCTIV
GVGDVSAGWSNSQWRSLKVQWDEPATIPRPDRVSCWEIEPFVASTALNVTQPAVKAASGF
WYHGSSNELSQLGAATAEVQSKENQVVPCSLRQKDIINSNPIDANNSSISSRVRMEGVWP
SSPHLNVTPNLFSDPNNNSVLARSPISGYLNVPSRSSDGPTCEHVEDGKKIENSLDCWLF
GVNLTNNCSNVIITTPSERELRGPISSSVAPSGPKESIPAAACETERVQTPNYSLSNKGQ
KQIISEASPNEWQNKQATVPSMRTRTKVQMQGVAVGRAFDLTTLSGYDDLIEELEKLFEI
RGELHSQDKWAVTFTDDENDMMLVGDDPWPEFCNMVKRIFICSREDLKKMKCCKLPASSS
EVEEVLLSPDSQNRDETQQSHMP
Download sequence
Identical sequences Glyma16g02650.1|PACid:16301238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]