SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma16g05110.1|PACid:16301538 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma16g05110.1|PACid:16301538
Domain Number 1 Region: 11-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.35e-25
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 203-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-23
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma16g05110.1|PACid:16301538
Sequence length 313
Sequence
MEAATFPHQLQVKPFHFFKIITAQNLQDGKLMIPNKFVEKYGEGLPNALFLKTPNGTEWN
FNLEKHDGKIWFQKGWKEFAEYHSLAHGHLLVFRRHGTSHFQVHIFDLSSLEIDYPSKGT
EGKTSPNHEGNKQPRNEENLEYLQPYQVRSHKSVKVENMMTLPEEAQPHTDTKFKVCISG
NFAEKSKVVVANQVTALDLASSFKPCNPFFLVVMRPSYIQSNGGPLPLQTKFCRRHFGLL
NKRHINLQVLNGRIWPAKYMIQKMKNKTNFRLTSGWKTFVKDNNLKVGNVCTFELIDGTK
LTLLVHIFRGTNX
Download sequence
Identical sequences Glyma16g05110.1|PACid:16301538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]