SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma16g05480.1|PACid:16301580 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma16g05480.1|PACid:16301580
Domain Number 1 Region: 185-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.28e-20
Family B3 DNA binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma16g05480.1|PACid:16301580
Sequence length 375
Sequence
MFPVSSPSIRHSLLGQSLTTTTTPWHQTLCHKLNPEKENQLLQSQKTKKTLCVCVCVSKK
KNPKLMMMDPRQREKLLHKTEACAFVAGVVPELSLVTVPGNNNNTNNVNNNNNNVSHSQS
HRKKRMARQRRSTNPTLLMNPLINNNNNKSGSSLPSPSTASSSHVPLSSSTLPPAREIDQ
RRLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKYR
FWPNNNSRMYVLENTGDFVNTHGLRFGDSILVYQDSENNNYVIQAKKASDQDEFMEETSD
TINDIFLNDYEVNKPGCFNVTYPAVNDTGMSFIYETTFSNDSPLDFLGGSMTNFSRIGPV
ETFGSVENLSLDDFY
Download sequence
Identical sequences Glyma16g05480.1|PACid:16301580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]