SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma17g36470.1|PACid:16307244 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma17g36470.1|PACid:16307244
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-24
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 2 Region: 19-117
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-22
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma17g36470.1|PACid:16307244
Sequence length 369
Sequence
SLSNVSAHDEKKVSQSFISSFPYFVRIMKSFNVSGSYTLNIPYQFSMAHLPNCKIKIILH
NLKGEHWTVNSVPTTRVHTSHTLCGGWMAFVRGNNIKVGDICIFELVHECELRVRIAEVA
KDGSDCQVGNLAITRPSAGHAVTSRCMPMNPKVNSKCIRKVDLSDKKWSKIGQETILSID
LKKSSRASNTSKKMGLCPQSKAAHKKLAAPRRHRVDDELSSQAKAGLRMLFALDEQRVAQ
AFTSPFPSFVKIMKKFNVSGSYTLKIPYQFSAAHLPTYKTEVTLRNSRGECWTVNSVPDA
KGRTVHTFCGGWMAFVRDNDINFGDTCIFELVAQCEMHVYISGVGKEGLDHQNGHLKLTN
RLANVPSTC
Download sequence
Identical sequences Glyma17g36470.1|PACid:16307244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]