SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma17g36490.1|PACid:16307246 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma17g36490.1|PACid:16307246
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-21
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 276-366
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000275
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma17g36490.1|PACid:16307246
Sequence length 407
Sequence
MINTLLALPKAFSDNLKKKLPENVTLKGPGGVVWNIGMTTRDDTLYFVHGWEQFVKDHCL
KENDFLVFKYNGESQFDVLIFNGGSLCEKAGSYFVRKCGHTGIEHAGGSLNKKRDTDNNS
LEEGNIPPSNAGVECALHEKSVHANGTKEPIDVPPETPPTEKTFNAGVESSGVEQFTPDG
GVTLVAVPSETANGKRIRNIVSAVKHVQTKRRGRPAKVHVRERTLDWVAALEASEPISTS
RSGTYEVYKSNRRPVTDDETKMIESLAKAACTEDSIYVVMKPSHVYKRFFVSMRGTWIGK
HISPSSQDVILRMGKGEWIARYSYNNIRNNGGLTGGWKHFSLDNNLEEGDACVFKPAGQM
NNTFVIDMSIFRVVPETVPLTPMSRGTGRRGRKQATMKSIQTQLSPP
Download sequence
Identical sequences A0A0R0FI62
Glyma17g36490.1|PACid:16307246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]