SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma17g37580.1|PACid:16307359 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma17g37580.1|PACid:16307359
Domain Number 1 Region: 138-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-46
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 830-907
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000137
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma17g37580.1|PACid:16307359
Sequence length 934
Sequence
MASVEEKIKTGGVGGGMVVGGQTLVAEMKLLKEMQEHSGVRKTLNSELWHACAGPLVSLP
QVGSLVFYFPQGHSEQVAASTRRTATSQIPNYPNLPSQLLCQVQNATLHADKETDEIYAQ
MTLQPLNSEREVFPISDFGLKHSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLD
YTIQPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDE
KSQLRVGVRRVNRQQTTLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYNPRACPSEFV
IPLAKYRKSVFGTQVSVGMRFGMMFETEESGKRRYMGTIVGISDVDPLRWPGSKWRNIQV
EWDEPGCGDKQNRVSVWEIETPESLFIFPSLTSGLKRPLPSGLLGKSLLLVIFLFLLCRR
WGTLLTRPFIRVPENGTMELSNSIPNLYSEHMMKMLFKPQLINNNGAFLSAMQQESAATR
AENQMLLKNLHPQSIPDQPNALNMQSLLKNDQPEKFHPLAKIDNHLPSGIVIDKPKLECE
VLPDRVIDYPSMEGCNNEKVAVNPVNQQGLATQLPFHNQNQSPLLPQSSPWPMQPLIESS
MPHPQMIGMAQADSAMVNGLFPQLDIDEWLAYASSQPFAGQNRPTGPFSDLQEHNSLQPQ
VVNPPLPSMNNEVWDHYVKNFKFLSQADQLTSICQPGMYGLNGVPSSNNLRDLSAESNNQ
SEICVNVDASNSVGTTMVDPSTSSTILDEFCTMKDGEFQNPQDCMVGNLSSSQDVQSQIT
SASLAESHAYPLRDIPDNSGGTSSSHVDFDESSFLQNNSWQQVPAPIRTYTKVQKAGSVG
RSIDVTTFKNYEELIRAIECMFGLDGLLNDTKGSGWKLVYVDYESDVLLVGDDPWGEFVG
CVRCIRILSPSEVQQMSEEGMKLLNSGALQGMNV
Download sequence
Identical sequences Glyma17g37580.1|PACid:16307359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]