SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma19g03000.1|PACid:16311724 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma19g03000.1|PACid:16311724
Domain Number 1 Region: 1-415
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.2e-104
Family UDPGT-like 0.00000595
Further Details:      
 
Weak hits

Sequence:  Glyma19g03000.1|PACid:16311724
Domain Number - Region: 609-689
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0863
Family B3 DNA binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma19g03000.1|PACid:16311724
Sequence length 711
Sequence
MLQFSKLLERQGVRITLVTTRFYSKNLQNVPPSIALETISDGFDEVGPQEAGSPKAYIDR
LCQVGSETFHELLEKLGKSRNHVDCVIYDSFFPWALDVTKRFGILGASYLTQNMTVNNIY
YHVHLGTLQAPLKEHEISLPKLPKLQHEDMPSFFFTYEEDPSMLDFFVVQFSNIDKADWI
LCNTYYELDKEIVDWIMEIWPKFRSIGPNIPSLFLDKRYENDQDYGVTEFKRDECIEWLD
DKPKGSVVYVSFGSIATFGDEQMEELACCLKESLGYFLWVVRASEETKLPKGFEKKTKKG
LVVTWCSQLKVLAHEAIGCFVTHCGWNSTLETLCLGVPIIAIPFWSDQSTNAKLMADVWK
IGIRAPIDDNKVVRREALKHCIREIMENEKGKEMKSNAIRWKTLAVKAVSDDAISHRLLL
GAPSNLDERAKMPFTISYKSQIVIHPYESLFNFFLCALPPSSVLLPPSSVSCLRDRAIRG
SAAVVVRAAAATVTVLCCVVAASSFFFSFEVSYPSSSIAVCLWLLLLVLLIDCVFLGVHC
VCLLLHWHFLQLTIDEHREWREMTNMMQNVAASLEAFFQTVHIRDQIFGEVSKVYAVKWN
DVLDGSITFKVYLTEQKVTCSSLDVPSSMYYFLKDKGWTHLHLEDVAECRLVFNHFRKTL
KIGVGWKHLCETLSLTVDMGIVFEFIDPNVVLAASIVSKSGKGEFSAALYT
Download sequence
Identical sequences Glyma19g03000.1|PACid:16311724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]