SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma19g06020.1|PACid:16312016 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Glyma19g06020.1|PACid:16312016
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00012
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma19g06020.1|PACid:16312016
Sequence length 463
Sequence
MHKMSTTSSTASTEMKNGIIRPPLIIQFITAFNNDKNTIQLPAFYHTQWAPNYPEFVHLR
YNGAIYEIRVRQHKDKVYLADGLQNFRKDLKIYESTSINFFACDHHSVFDIHFIPPLERQ
TCGRQRHSSRKHIWTLQLTQEMLDDPEPLKLPHCTEVPLKACGNHMTVLRRHGPPLQWKV
ETLNPAIGGKGQPQNLLPKCAVVNVVHTTANCSQSQIGDNAAPPLTLLLAPRSPDKFLMP
PNEEPSNDNISNPNHPLLFQNHPYPTCSSSSVGPTVIFIVSSPHRAGILLRLYRRRRETP
SFARVTDVRCSHKDLLRFEPNLGVVLDAKHGAAVRLAGSVNYFALHAPSSNKVWVFAVKD
DGDGGGDGNDGDGGVRLMRCAVIECSRPVFSVSVAFGFLILGEENGVRVFGLRRLVKGRS
GKRVGNSKPLKNGGRGGGLEAVNCNGDLEGKMERHGGVTTAGR
Download sequence
Identical sequences Glyma19g06020.1|PACid:16312016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]