SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma19g45090.1|PACid:16314994 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma19g45090.1|PACid:16314994
Domain Number 1 Region: 88-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-29
Family B3 DNA binding domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma19g45090.1|PACid:16314994
Sequence length 413
Sequence
MELMQQVKGNYSDSREEEEAAAEIITITREPESSRLHQQDAASNFGKKLDLMDLSLGSSK
EEEEGKLQQGGGGGGVVHHAHEIVEKENMFEKVVTPSDVGKLNRLVIPKQHAEKYFPLDS
SSNEKGLLLNFEDRNGKVWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGLG
DLYRHRLYIDWRKRSAHPHAHHHAPDPLFLPSIRWYSLPPTMPPRYHHDHHFHHHLNYNN
LFTFQQHQYQLGAATAAATAAHHGDQNSGSGSLYYLRSSMSMGGGDQNLQGRGNNIVPMI
IDSVPVSVGHHNNRHGNGGITSGGATSSGKRLRLFGVNMECASSAEDSKGLSSGSAAHVT
TAASSSLHQRLRLPLPHEDPLSSSSARFGDHKGGSTGTSLLFDLDPSLQYHRQ
Download sequence
Identical sequences A0A0B2PV20 I1NCS4
Glyma19g45090.1|PACid:16314994 XP_003553806.1.40590 XP_006604926.1.40590 XP_014627637.1.40590 XP_014627638.1.40590 XP_014627639.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]