SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma20g01130.1|PACid:16315121 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma20g01130.1|PACid:16315121
Domain Number 1 Region: 291-392
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-24
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-24
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma20g01130.1|PACid:16315121
Sequence length 435
Sequence
MPRPCFHKLVLPTTLQSRQLRIPDNFLRKYGTQLSTIATLTVPDGSVWRIGLKKADNRIL
FVDGWQDFVQHYSIGVGYFLVFMYEGNSSFIVHIFNLSTSEVNYQSAIRNRNEGSCLANY
HHIFDEMEDVDSLDLSDLSPQYLTPGSLQNKGCVGSVDQLTPGKSHTPALQNLFNGGSKL
NRINWGDGGSAFSSKNANSQGNQSTRDIGVQFNANEFKRSTEELKLRYSNEETVNKTAKK
KRKSEPYGEEPSGENEEEAEMRYRFYESASARKRTVTAEERERAINASKTFEPTNPFCRV
VLRPSYLYRGCIMYLPSCFAEKNLNGVSGFIKLQLSNGRQWSVRCLYRGGRAKLSQGWFE
FTVENNLGEGDVCVFELLRTKEVVLQVTVFRVTEDAGLLNQPPMMQQQHIPNMSHTKLLN
PHLQHRVSTTKLIRN
Download sequence
Identical sequences A0A0B2NPL0 I1ND23
XP_003555681.1.40590 Glyma20g01130.1|PACid:16315121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]