SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma01g39390.1|PACid:16245710 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma01g39390.1|PACid:16245710
Domain Number 1 Region: 72-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000726
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma01g39390.1|PACid:16245710
Sequence length 180
Sequence
FINHTEDLHDVHITDKAIDFFFKVTKKDIRIKLKQIEERPKEERIMPAMIKKPRKIILNR
VTELSGHDLKYLMHKRLFCSDVRPNNNRLSMPMNEIMCEFLTQDEIEKLDERDGSNGKGR
LKWSMQRTDTYNLVTNWNRIVFINEFEEGHELQIWSFREGAMFVALCYMYSCFTFMSCDA
Download sequence
Identical sequences Glyma01g39390.1|PACid:16245710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]