SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g03770.1|PACid:16246879 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g03770.1|PACid:16246879
Domain Number 1 Region: 182-266
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000243
Family Myosin rod fragments 0.029
Further Details:      
 
Weak hits

Sequence:  Glyma02g03770.1|PACid:16246879
Domain Number - Region: 42-128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00736
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma02g03770.1|PACid:16246879
Sequence length 273
Sequence
MSKEKDSDDNQVDTFSDSVMLERFHTLVEIDNLNLEPDWDPITELESILSDSYNMSSMST
HSATISQIEVHGTNVAAILEKLEVLLETSLEILSSDDEVKQQFHHVLEQLNQFKDQIPVR
LHAVIYKLKSFIEDVDIRYATAQRTIQDYDQLLQSRSLLSKNLESAKAQQDKINLKVSEG
KIQFEKINSEIDELEHKLCTLVMTRDKLKRALDNCAAENNKLKTQVAKWVPECKSIITAL
KEYETSYKVALTNKRKTEDEWADLKKTFVANKI
Download sequence
Identical sequences K7K674
Glyma02g03770.1|PACid:16246879 XP_003520014.1.40590 XP_006574598.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]