SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g06950.1|PACid:16247238 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g06950.1|PACid:16247238
Domain Number 1 Region: 147-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000632
Family Cystathionine synthase-like 0.01
Further Details:      
 
Weak hits

Sequence:  Glyma02g06950.1|PACid:16247238
Domain Number - Region: 755-849,887-914
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00334
Family Cystathionine synthase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma02g06950.1|PACid:16247238
Sequence length 933
Sequence
MHLSLWKPISQCAALIMDKKSRRKEESNVEMRRNPSMLRKLQENKLREALEEASEDGSLS
KSQDIDQPDSAANQDDGLGRSRSLARLHAQREFLRATALAAERIFESEEEIPSLQEAFAK
FLTMYPKYQSSEKVDQLRSDEYSHLSPKVCLDYCGFGLFSFVQTIHYWESSTFSLSEITA
NLCNHALYGCAERGTVEYDIKARIMDYLNIPENEYGLVFTVSRGSAFKLLADSYPFHTNK
KLLTMFDHESQSIAWMAQSAREKGAKVHSAWFKWPTLKLCSTDLRKQISNKKKRKKDSAT
GLFVFPVQSRVTGAKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPDFIVTSF
YRVFGYDPTGFGCLLIKKSVMQSLQNQSGCTGSGMVKITPEFPMYLSDSVDGLDKFVGIE
DDDEITGIGDKTTETRQGTQLPAFSGAFTSAQVRDVFETEMDQDSSERDGTSTIFEETES
ISVGEVIKSPVFSEDESSDNSFWIDLGQSPLGSDSAGQSNKHKTASPLPPFWFNGRRNQK
QHSPKPTSKMYGSPMYDDREVNLGAHEDRRVLSFDAAVLMSQELDRVKEVPEEEHVEEVD
HYSRNGNGSDHLHVDEIVEEPGTSEAVNNGSWLNSTSLARHQSLENGSTSEICPDVKESA
IRRETEGEFRLLGRREGNRYGGGRFFGLEENEANSRGRRVSFSMEDNRKEYLSQALEPGD
ISATSFDDEEVTSDGEYGDGQDWGRREPEIICRHIDHVNMLGLNKTTLRLRFLINWLVTS
LLQLKLPASDGGEKASLVQIYGPKIKYERGAAVAFNVRDRSRGLINPEIVQKLAEKEGIS
LGLGFLSHIQILDNSRQHRGAPNFEDITLCRPMENGRRDGKGSFVRLEVVTASLGFLTNF
EDVYKLWAFVAKFLNPTFIREGGLPTVQEGSET
Download sequence
Identical sequences K7K6R8
XP_003518086.1.40590 Glyma02g06950.1|PACid:16247238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]