SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g40280.1|PACid:16249662 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g40280.1|PACid:16249662
Domain Number 1 Region: 239-329
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000011
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma02g40280.1|PACid:16249662
Sequence length 588
Sequence
TLHCGCIASSSMFEYLDYGGIGCVTCVKTSQLNLIRDTENTIGSVRSIKNNASDRHTEHM
DSRLLVDGAGKGNLMQLRRHVEASESSRWQRAERDGIDSCIGPNRQDDRRFSNVMKLSGH
SLTFTTLDNNRPTWETQTMHKSSSQNMSLGTSSGNSVLPSALDIAERRLEGQRLFSISKP
LMDGIAINLEASKGVISQERVARPPANGKTKNLLLSRYWPRITDQELEKLSGDLKSTIVP
LFEKVLSASDAGRIGRLVLPKSCAESEGLPLQFKDVKGNDWTFQFRFWPNNNSRMYVLEG
VTPCMQAMQLNAGDTVMFSRIDPGGKFVMGSRRASDSIDTQVEATFSGATANLHSGNSYP
DLLRTTKGNGEPYLNRYSEHLRFSTETANCLQTENDMELRVTWEEAQDLLHPPPCVKPSV
ETIEDKEFEEFEEPPVFGKGTTINDHPSGSLSSASEEMSSRELENILVTSKDTKKRRIME
KPESIQEHESVGLDDHIDPTDSSAGATTKHPRHRSGCTCIVCIQPPSGKGRHRPTCTCLA
CMTVRRRFKTLMMRKKQRESDATQKDQIHHSDEGDTNGGASRDGAIAX
Download sequence
Identical sequences Glyma02g40280.1|PACid:16249662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]