SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g40650.1|PACid:16249707 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g40650.1|PACid:16249707
Domain Number 1 Region: 112-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 719-795
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000638
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma02g40650.1|PACid:16249707
Sequence length 847
Sequence
MKLSTSGLGQQGHEGGEKKCLNSELWHACAGPLVSLPTAGTRVAYFPQGHSEQVAATTNR
EVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTFLPMELGVP
SKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYPSLFPLRLKRPWHPGTSSFHDGRDEATNGLMWLRGGPGDQALNSLNFQGSGLLP
WMQQRMDPTLLANDHNQHYQAMFASGLQNLGSGDLMRQQIMNFQQPFNYLQQSGNPNPPL
QLQQPQAIQQSVSSNNILQPQAQVMAENLSQHLLQKSHNNREDQTQQQQQQRHTYQDTVL
LQSDQLHQRQHSGLPSPSYSKPDFLDSSMKFPASVSPGQNILGSLCPEGSGNLLNLSRSG
QSMLTEQLPQQSWAPKFTPLQVNAFGNSMQHVQYSGKDTAMVPPHCNSDTQNPILFGVNI
DSSGLLLPTTVPRYTTASADSDASAMPLGESGFQSPLYPCGQDSSELVQSAGQVDPQNQT
RTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDV
LLLGDDPWESFVNNVWYIKILSPEDIHKMGEQALESLGPSPGQRLNSTGADSHEIVSGLP
SIGSLEY
Download sequence
Identical sequences I1JHQ8
Glyma02g40650.1|PACid:16249707 XP_006575466.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]