SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g45100.1|PACid:16250234 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g45100.1|PACid:16250234
Domain Number 1 Region: 114-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-49
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 752-836
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000085
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma02g45100.1|PACid:16250234
Sequence length 896
Sequence
MKLSSSGFNPPAEEEGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNR
EVDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQEQKEVYLLPAELGT
PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTIMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFAIPLAKYVKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEP
LTTFPMYPSPFPLRLKRPWPSGLPSLYGLKDGDMGIGSPFMWLQGGLGDQGMQSLNFQGL
GVTPWMQPRLDPSIPGLQPELYQAITSSAFQEMRTMDLSKSSQSLLQFQQTSNVPSAHAS
EVQRQLLPQSQLQNTLLHNFQENQVPAQSQLLQQQLHRYHPYSDQQQQQQQLKNLPVQQQ
LPNVISPMSKFASGTQSQSPPMQALASHCQQQSFPEPMRNHISGSDVSPIQSLLGSFSQD
GTSQLLNLSGSNSVMSSAAILPKQITAEPPQLPSAASQCILPQVENLGTSQSNVSELAAL
PPFPGREHSAYHGAADPQSNLLFGINIDPSSLMLQSGMSNLRNIGKVNDSLSLPFSTSNC
GGATGTDFPLSSNMTTSSCVDESGFLQCSENVDQANIPTGTFVKVHKSGSFGRSLDISKF
SSYDELISELARMFGLEGQLEDPKTQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIK
ILSPLEVQQMGKVLSPSTSAPGDKLSTPVNSCDNYVSQQELRSSRNGMASMGSFHY
Download sequence
Identical sequences I1JIZ7
Glyma02g45100.1|PACid:16250234 XP_003519519.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]