SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g45260.2|PACid:16250254 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g45260.2|PACid:16250254
Domain Number 1 Region: 259-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-16
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 60-187
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000188
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma02g45260.2|PACid:16250254
Sequence length 507
Sequence
MDNSNDSSSSLSFVSSRLSHGSSNHNVSSSTSNEHGANIEILSLNKLSGSLEKLLIETEY
DYSDAEILVEDIPVGIHRCILASRSLFFHELFKKGTDGSGKEGKPRYLMSDLVPYGTVGY
EAFQVFLYYLYTGRLKASPTEVTTCVDETCTHDACRPAINYALELMYASATFQMKELVLL
FQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSDFDNTSLEKELPREVVT
EIKLLRLPFQPESTPNAMEVESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDAHAL
HYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGACASDTT
PDGQTALAICQRLTRYKDYQEQTVQCKESNKDRLCVDVLEREMRRNSMTVNMSVSSQLTA
NDLHMRLDYLEDRVAFARLFFPAEARVAIENAEADSSSMYANSSALKGTNGNLKQVDLNE
SPSAHTRKLQLRLHALMKTGMSKTILK
Download sequence
Identical sequences I1JJ14
Glyma02g45260.2|PACid:16250254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]