SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma02g46090.1|PACid:16250356 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g46090.1|PACid:16250356
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000235
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma02g46090.1|PACid:16250356
Sequence length 118
Sequence
EVKFVTQKKLFKTDLNPQHARLSIPPAKIANRFLTPTEESSLNERRGKHKRLSGMPVMVL
DPSLREYNMCFKKWEMTKSYVYNLTMGWNQIVGDNHLKLGDTLHLWSFRLSSQLCFAL
Download sequence
Identical sequences Glyma02g46090.1|PACid:16250356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]