SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma03g17450.1|PACid:16251876 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g17450.1|PACid:16251876
Domain Number 1 Region: 117-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.02e-38
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 582-656
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000105
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma03g17450.1|PACid:16251876
Sequence length 691
Sequence
MLSRAANGEVAGSGYSGEDEMYEPLWKGCAGPLVDVPRVGQRVFYFPQGHMEQLEASTNQ
ELNQRIPLLKLPTKILCRVVNVHLLAEQETDEVYAQITLVPESNQDEPMNPDPCTAEPPR
APVHSFSKVLTASDTSTHGGFSVLRKHAMECLPALDMSQPTPTQELVAKDLHGYEWRFKH
IFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGDNGELRVGVRRLARQASSMPSSVIS
SQSMHLGVLATASHAVATQTLFVVYYKPRTSQFIISVNKYLEAMNRFSVGMRLKMRFEGD
DSAETDKRFSGTIVGVEDISPHWVNSKWRSLKVQWDEPAAVPRPDRVSPWEIEPFVASAS
TPSVQPTMVKTKRPRPPSETPDVDTTSAASVFWDAGLQQADMAQKNVLAESKRNDSTGTW
HHMQTDMNSKSNSGNAMLRNQTEGSWLSSPHSSCPSHLFQDATDDSKSVSAWPVSKPHSS
RLNNDHVLDQVDKESKVETATSYRLFGIDLIDHSRNSPSVEKASAQAGNAPKVTTEGCTS
TLTRTDAGHLSDVPMASSKERKQEQQQVSPKETQSKQICRSRTKVQMQGVAVGRAVDLTM
LDGYDQLINELEEMFDIKGQLQHRNKWEIVFTDDEGDMMLVGDDPWPEFCNMVRRIFICS
SQDVKKMSCGSKLPISSVEDGTVISSDTTET
Download sequence
Identical sequences I1JM14
XP_003520962.1.40590 Glyma03g17450.1|PACid:16251876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]