SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma03g25330.1|PACid:16252303 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g25330.1|PACid:16252303
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000432
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma03g25330.1|PACid:16252303
Sequence length 141
Sequence
MIKKPRSIILVQNRPSPDLPAEFKNRVSELSGHDLKFLMHKRLFCSDVKPNSNRLSMPIN
EIKCEFLTEAEITKLDERDGPNGKGRLVGVEVTVLDPCLREFTLPLKKWSMQRTDTYNLV
TNWNSIVSTNKFEEDQELQIX
Download sequence
Identical sequences Glyma03g25330.1|PACid:16252303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]