SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma04g24640.1|PACid:16256300 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g24640.1|PACid:16256300
Domain Number 1 Region: 54-166
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000184
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma04g24640.1|PACid:16256300
Sequence length 173
Sequence
MSNPSDEKEQCQKKRKSTICEASNFKTSRRRFFSNKNEEDMNKGVSTTLKLYDDPWKIKK
TLTDSDLGILSRLSLAADLVKKQILPMLGADHARAAETEEGTPVRVWDMDTKSMHQLVLK
RWSSSKSYVLIGKWNQDFVRRRDLKKGDEIGFHWDPYNCVFNFCVLKRAMPEN
Download sequence
Identical sequences A0A0B2QG94 A0A0R0K8R8
Glyma04g24640.1|PACid:16256300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]