SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma04g36750.1|PACid:16256971 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g36750.1|PACid:16256971
Domain Number 1 Region: 27-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-18
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 531-596
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000353
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma04g36750.1|PACid:16256971
Sequence length 619
Sequence
MCGERQRVSACAACTNNCLLFHKTKQTSPTSFFKLITKREHLTTLYIPPAFSSTVSDLVN
KKIALNDSSERQWNVKVSGFNGSFAFMEGWSTFSLNHGVKVGYLLVFNYVKDLHFDVKIY
DPSACEKLNFPKTRNQKKRSRGRSGSPVRDCMLVGQESNALVVTQHYVPKMKSQRSEVDL
VVRKNGEESGQLMCISELHEDPCYSTSLEFDQSHGVNGTMKIVNGDLKVSNVDYGSHIFE
NDAIVCSKDTMFEGIFSMAAALDISEFEMSGRSTSLGEADKSTHDKTSTLNIEENKESKA
IMYSGEAQECQFSNVLESDQAAISKKEPALHIDGSCNTKNKFNEISNHLDTYIHNGEMKK
LPVDKTPKLYSSVDKLNVTGLPKETKGKLDHYSDPFNQDNESHFKTAPPLMSNGEAQECQ
FSEGLESDQAAISKKEPALHICGFSDTKQNFDGISNDLDGHIYNGEMKKLPMDMTPKLCG
SMDKLNITELPKEIKDSDISNQDDESHFKTAPPLSCVVTNDNDNVSLKLPEYLPLTRRVK
PFTHKKMVVLLRDSQMRLWPVFYHEQPRLLTHGWLDFSRANNIQPEDECIFEVEPDPESR
YQRILAYILGSYTTMTSRQ
Download sequence
Identical sequences Glyma04g36750.1|PACid:16256971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]