SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma04g43620.1|PACid:16257788 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g43620.1|PACid:16257788
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-17
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma04g43620.1|PACid:16257788
Sequence length 242
Sequence
MQRIPEEFIKRFGDELSNVATVTVPDGRVWKMRLKKCGKDVSFRSKWREFVEYYSLGYGS
YLVFRYEGNSKFRVLIFDTTSAEICYPDLDNRKRSKVDDQTRKKEHKEAIDEDDVNLKAW
KKESDCSEIAKDASTKPKHPSVTCTIQPYRLYVRSHFSKKHLKPNVCMMLQNCNGEQWDV
SCVCHNTRYGGMMLTRGWRKFVRDNDLSEGDPCVLELIETNPAVVLKLTVLGAPEYHSSR
PH
Download sequence
Identical sequences Glyma04g43620.1|PACid:16257788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]