SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma05g03590.1|PACid:16258198 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma05g03590.1|PACid:16258198
Domain Number 1 Region: 131-491,532-560
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.03e-18
Family Cystathionine synthase-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma05g03590.1|PACid:16258198
Sequence length 568
Sequence
SHRTTSKPKVNNDATSSHDDFVAATSSTLHPHTNFTNHESLPSLQDSYISFTKVFPQFST
TSEVDRIRAREYHHLNHSSNSCFDYTGYGLFSYDQQQRSYSYPTVASSSSSSLPYFTSDA
SFFDISYKSVNLQSQVLYGGHESELESRIRKRIMSFMNVSEAEYTLVFIANEVSAFKIVA
DSFQFQNNRQLLTVYDHSSEALDVMIESCKKQGVHVLSAEFSWPNLGMEWRKLKKMVTKN
KREKRKGGLFVFPLHSRVTGAPYSYVWMSMAQEHGWRVLLDVCGLKPKEMGTLGMSLFKP
DFMVCSFYKVFGENPSGFGCLFVKKSSVSALKDPGNAISIGIISLVPAFRHETNEQVVIE
TETEHHQQVEIEELSIPFDSSTDRNRLGTKNEGLEIHCRGLDHADSVGLLLISSRTKYLV
NWLVNALMSLKHPHHEDSISLIRIYGPKISSLRGPAVAFNIFDWKGEKIDPALVQKLADR
NNISLGSSYLRNIRFSDKNEEERHYWALETRGGSEVEGLGLSKKTRSQEPGIFVVTAALG
LLTNFEDIYRLWAFLSRFLDADFVEKEX
Download sequence
Identical sequences Glyma05g03590.1|PACid:16258198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]