SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma05g36430.1|PACid:16260906 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma05g36430.1|PACid:16260906
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.16e-42
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1000-1065
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000054
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma05g36430.1|PACid:16260906
Sequence length 1099
Sequence
MKAQPPDGAAAVAPNAGEGGEKKTINAELWQACAGPLLNLPSPGTHVVYFPQGHSEQVAA
SLKKDVDAQVPNYTNLPSKIPCLLHNVTLHADPDTDEVYAQMTLQPVPSFDTDALLRSDI
FLRSSKPQPEFFCKQLTASDTSTHGGFSVPRRAAEKIFPPLDYSVQPPAQELVARDLHDN
VWRFRHIYRGQPKRHLLTTGWSLFIGGKRLLAGDSVLFVRDEKQQLLLGIRRANRQPSNL
SSSVLSSDSMHIGVLAAAAQAVANNSPFTVFYNPRASPSEFVIPLAKYSKAVYSHHISPG
MRFRMMFETEDSGTRRYMGTIIGVSDLDSVRWKNSLWRNLQVGWDESTAEERQSRVSVWE
IEPVTTPYFICPPPFFRSKIPRLLGMPDDEPDFNNLFKSTVPWLGDDMCVKGPQALPGLS
LVQWMNIQQNPALASSLQPNCGPSMSGLVLQNLPGADIANPLGFSTSQISQSNNVSVDAQ
NILQTSQQLDHIQKPPCPSSALGAVTQPLQQLGDITQQPRNLTNQTLPHDQAHTQLLNPQ
RVVQTNNIHQQQQSSIQKQQLLRSLSQNRAQKHQQTTLGLNERQIVFQSPMPDHFNQQLQ
MSDNQVRFQLLQKLQQQQQTLLAQQSALQQPALIQIQDQQRQLLDVANNSSSPIPGQVLE
NLPTLQNSLPEANSITHQITMPSSQKNFHYSHLSQQPALLSEMSGHVGLPPTVTTNPLSA
SGGSILTGVGQSVITDDVPSCSTSPSTNNRASVLPPVVSSQIHRSTTIGDDMAQSAVTIS
GASTLETMSSNANIVQPKYEVKASLNISKNQNQGNVAPQTYLNGVVQTDYLDSSSSTTSL
YHFRSDTHMHQNTNPFSYNPQLVYCRDNSQNVEVQADARNNVLIGNNVNGQMGMPSNLDS
LLTKGTVGLGKELSNKFASGGLLRDLENNKGVPPEISSSMVSQTFEVPDMSFNSIDSTID
GSSFLNRGPWDLPPPPPPQQQQVQRIRTYTKVYKRGAVGRSIDITRYSGYEDLKQDLALR
FGIEGQLEDLQRIGWKLVYVDHENDVLLVGDDPWEEFVNCVRCIKILSPQEVQQMSLDGD
FGNGGLPYPAGSSSDGGNA
Download sequence
Identical sequences I1K651
XP_003524425.1.40590 Glyma05g36430.1|PACid:16260906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]