SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma06g17320.1|PACid:16263270 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma06g17320.1|PACid:16263270
Domain Number 1 Region: 138-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-40
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 715-790
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000785
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma06g17320.1|PACid:16263270
Sequence length 843
Sequence
MASSEVTMKGNCLNHNDGGATEPHSPSTAKDAEAALFRELWHACAGPLVTVPREKERVFY
FPQGHIEQVEASTNQVADQHMPVYDLPPKILCRVINVQLKAEPDTDEVFAQVTLLPEPNQ
DENAVEKEPPPPPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSKQPPTQ
ELVAKDLHANEWRFKHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGV
RRAMRQQGNVPSSVISSHSMHLGVLATAWHAILTGTIFTVYYKPRTSPAEFIVPYDQYME
SLKNSYSIGMRFKMRFEGEEAPEQRFTGTVVGIEDSDPKRWRDSKWRCLKVRWDETSNTP
RPERVSPWKIEPALAPPALNPLSMPRPKRPRSNAVPSSPDSSVLTREASSKVSIDPSPAN
GFPRVLQGQEFSTLRGNFTESNEFDTAEKSVVWPPTAVDDEKMDVSTSRKYGSESWMSMG
RNEPTYSDLLSGFGTSGDPSHSSLKDQMSPAYSARKQSLDHEGKLHMPHPWPVMPSSLSL
NILDSNAKGPTHGGDTSFQARGNLRFSAFGEYPALHGHKVEDSHGNLMPPPPAPQTQYQS
PCSRELMSKHVSAKTCEAVKPKDGDCKLFGFSLISGPIVPEPSLSQRNVSEPAGQMHLTA
HQQRTSENDEKSDHSKGSRPVDDLVVDDHDRPLQTSQSHTKDVQAKPLSGSARSCTKVHK
KGIALGRSVDLTKYSGYDELVAELDQLFEFGGELLSTKKDWLIVYTDNEGDMMLVGDDPW
QEFCAMVCKIYIYPKEEIQKMSPGTLSSKNEENQSVMASDGADAKVVKCQPHQKFNSENG
LDA
Download sequence
Identical sequences I1KBY0
XP_003526928.1.40590 Glyma06g17320.1|PACid:16263270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]