SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g06500.1|PACid:16266413 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g06500.1|PACid:16266413
Domain Number 1 Region: 22-432,459-516
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.86e-126
Family Pyridoxal-dependent decarboxylase 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma07g06500.1|PACid:16266413
Sequence length 519
Sequence
MEMKNTMNRNPQSDAPIIKPLDPEEFKRQGYMMVDFLADYIRNVSHYPVLSKVEPGYLKQ
RLPTSAPCGPEPIESILKDVQDHIIPGLTHWQSPNFYGYFPSSGSIAGFMGEMLSAGLNV
VGFNWVSSPSATELESIVMDWLGQVLNLPKSFLFCGDHGGGVVLGTTCEAILCTLVAARE
KKLSQVGKENIGKLVVYGSDQTHSALQKAAQIAGIHPANFRVIKTKRSNSFALSPDSLLS
TILLDVERGLIPCFLCATVGTTAIATIDPIGPLCNVAKDYGIWVHVDAAYAGSACICPEF
RHCIDGVEEVNSFSLNAHKWFLTNLTCCCLWVKDHIALTKSLTVNPQFLRNKASESKRVI
DYKDWQIPLSRKFNALKLWLVLRSYGVENIRNFLRNHVQMAKTFEGLVRLDKRFEIVVPP
KFSLVCFRIAPSAIIANGLSKGVEACYNGKLVNDEYMVNEVNRKLLDSVNSSGDAFMTHG
EVEGAFMIRCAIGGTLTEEHHVIMAWKLVQEHANSLLGL
Download sequence
Identical sequences I1KHY8
Glyma07g06500.1|PACid:16266413 XP_003529905.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]