SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g15640.2|PACid:16267394 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g15640.2|PACid:16267394
Domain Number 1 Region: 115-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-42
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 954-1019
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000677
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma07g15640.2|PACid:16267394
Sequence length 1091
Sequence
MCVLTTIIILVGAEKKKSINPELWQACAGPLVNLPPSGTHVIYFPQGHSEQVAASLNKDP
HSQIPNYPNLPSKLLCLLHNLTLLADPETDEVYAQITLQPVPSFDKDALLRSDLALKSSK
PQPDFFCKQLTASDTSTHGGFSVPRRAADKIFPPLDYSMQPPAQELVARDLHDTVWTFRH
IYRGQPKRHLLTTGWSLFVSGKRLLAGDSVLFIRDEKQHLLLGIRRANRQPTNISSSVLS
SDSMHIGILAAAAHAAANNSPFTVFYNPRTSPSEFVIPLAKYYKSVYSHQPSLGMRFRMM
FETEDSGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGEKRSRVSLWEIEPVTA
PFFICPPPFFRSKRPRQPGMPDDELSDFDNIFKRTMPWLGDDMCMKDPQGLPGLSLAQWM
NMQQNPALANSLQPNYAPSLSGSILQNIPGADISRQLGFSAPQISQSDNQQLGDITQQPR
QNLANQTIPQGQVQSQLLHPQNMVQTNNILQQQQPSIQNHQLHRSLSQNPSQQQTTIGQN
QPQNLIQSPMPDHVQQLQMSDNQIQLQLLQKLQQQKQTLLAQQTALQQPTQLTQIQDQQR
QLLDKTHNLSRALTPGQVLEIPHIIQNSLPEANSISNQMTKANCQSNIQFSQQPKLQQQQ
QPGMVSEMPGHMALLPTATTNQLSAGGSSIVTGAGGAGQSVITDDVPSRSTSPSTNNWDD
MAHSAATILSSSALETSSSNANMLKDLQPKFEVKPSLNISKIQNQGHFAPHTYLNGNAAH
TDCLDTSSSTTSVCLSQSDAHMNQNSNPLSYNRQSMLFRDNNQDGEVQADARSNIPYANN
IDSQIGMPLNPDSLLTKGTLRLGKYLSNNFSSEGMLGNYENNRDAQQELSSSMVSQTFGV
PDMAFNSIDSTIDDSNFLNSGPWAPPPAPPPLPPAQFQRMRTYTKVYKRGAVGRSIDITR
YSGYEELKKDLARRFGIEGQLEDRQRIGWKLVYVDHESDVLLVGDDPWEEFVNCVRCIKI
LSPQEVQQMSLDGDFGNGGLQNQACSSSDDYFWEMHYCPNSERQLLCHCGLLCPPSGLER
RSFVYVPDMQI
Download sequence
Identical sequences Glyma07g15640.2|PACid:16267394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]