SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma07g35040.1|PACid:16268769 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma07g35040.1|PACid:16268769
Domain Number 1 Region: 43-136
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000471
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma07g35040.1|PACid:16268769
Sequence length 182
Sequence
MFSRRSSGRVASGRVALENGVPLPLLPDPKANLQWDEVKPLSGKPYWHSVLSPTNLQPRY
NLMPGMNLRSKLPSNEVPTILIYGGKSWDMVYYGQSKQKAFGVTGWKKFVIDNCLRVGDA
CIFELMESSDKKVILEVQILRGDIPSEWLGNEMIIGQGNEMIIGQENEMIIGHSRENPIV
LN
Download sequence
Identical sequences K7L3A1
Glyma07g35040.1|PACid:16268769 XP_003529446.1.40590 XP_006583943.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]