SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma08g01100.1|PACid:16269526 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g01100.1|PACid:16269526
Domain Number 1 Region: 150-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-40
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 729-804
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000132
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma08g01100.1|PACid:16269526
Sequence length 851
Sequence
MATSEVSIKGNSVNGKGDNSSGDARNSGGEAQNASSSSSSARDAEAALYRELWHACAGPL
VTVPRERERVFYFPQGHIEQVEASTNQVAEQHMPVYDLPPKILCRVINVMLKAEPDTDEV
FAQVTLLPEPNQDENAVEKEGPPAPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECL
PPLDMSKQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIF
LRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAILTGTMFTVYYKPRTSP
AEFIVPYDQYMESLKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDADTKRWPKSKWRS
LKVRWDETSNIPRPERVSQWKIEPALAPLALNPLPMPRPKRPRSNVVPSSPDSSVLTREA
SKVSVDPLPTSGFQRVLQGQELSTLRGNFAESNESDTAEKSGVWPPATDDEKIDVSTSRR
YGSDSWMSMGRHEPTYPDLLSGFGAHGDHSSHPSFVDQNGPVANLSRKHLLDREGKHNVL
SPWPGVPSSLSLNLLDSNLKGSAQGGDTAYQVRGNLRYSSAFGEYPVLHGHKVEHSHRSF
LMPPPPSTQYESPRSRELLSKPISGKPCEVSKLKDSDCKLFGISLLSSRPIASEPSLSQR
NVTSESVGHMHTASHHQRAIENDQKSEHSRGSKPADGLLIDDHEKVLQTSQPHLKDVQAK
SHSGSARSCTKVHKKGIALGRSVDLTKFSDYGELITELDQLFEFGGELTSPQKDWLIVYT
DNEGDMMLVGDDPWQEFVAMVRKIYIYPKEEIQKMSPGTLSSKNEENQSASEGAADAQEI
ECQLNHSSSDT
Download sequence
Identical sequences I1KP28
Glyma08g01100.1|PACid:16269526 XP_003532359.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]