SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma08g03140.2|PACid:16269783 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g03140.2|PACid:16269783
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 812-868
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000873
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma08g03140.2|PACid:16269783
Sequence length 902
Sequence
MITQPPDAAPAVAPNSGEGGEKKSINAELWQACAGPLLNLPSPGTHVVYFPQGHSEQVAA
SLKKDVDAQVPNYTNLPSKIPCLLHNVTLHADPDTDEVYAQMALRPVPSFDTDALLRSDI
SLKLSKPQPEFFCKQLTASDTSTHGGFSVPRRAAEKIFPPLDYSLQSPVQELVARDLHDN
VWRFRHIYRGKPKRHLLTTGWSLFISGKRLLAGDSVLFVRDEKQQLLLGIRRANRQPSNL
SSSVLSSDSMHIGVLAAAAQAVANNSPFTVFYNPRASPSEFVIPLAKYYKAVYSHHISPG
MHFRMTFETEDSGTRRYMGTIIGVSDLDSVRWKNSLWRNLQVGWDESTAEDRRSRVSVWE
IEPVTTPYFICPPPFFRSKRPRLLGMPDDEPDFNNLFKSTVPWLGDDMCIKDPQALPGLS
LVQWMNMQQNPALASSLQPNCVPSMSGLNILQTSQQLDHIQKLPCPSSALGAQQSSIQNH
QLLRSLSQNPPQKDQQTTFGQNERQNLQMSDNQVRFQLLQKLQQQQQTLLAQQSALQQPA
LIQVQDQQRQLLDVTNNSSSLISGQVLENPPTLQNSLPEANSVTHQITMPSSQKNFHYSH
LSQQPALLSEMSGHAGLLPTVTTNPLSASGGSILTGAGQSVITDDVPSCSTSPSTNNRAS
ALPPVYEVKPSSNISKNQNHGNVARQMYLNGVVQTDYLDSSSSTTSLYHFQSDTHMHQNN
NPFSYNPQLIYCRDNSQNVEVQADARSNVPFVNDINGQMGMPSNLDSLLTNGTPELSSSM
VSQTFEVPDMSFNSIDSTIDVCFLISMLVYGHYVELKQDLALKFGIEGQLEDRERIGWKL
VYVDHENDVLLVGDDPWEEFVNCVRCIKILSPQEVQQMSLDGDFGNGGLPYPAGSSSGGG
NA
Download sequence
Identical sequences Glyma08g03140.1|PACid:16269782 Glyma08g03140.2|PACid:16269783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]