SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma08g47240.1|PACid:16274136 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g47240.1|PACid:16274136
Domain Number 1 Region: 562-658
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-24
Family B3 DNA binding domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma08g47240.1|PACid:16274136
Sequence length 717
Sequence
MECEVELQGGDLHAGEVTDPNPIGFGNMEDEHTLAVAEREMWLNSDQDEFLGVNDASMFY
ADFPPLPDFPCMSSSSSSSSATPLPVKTMTCSTTTTTSSSSSSSSWAMLKSDAEEDAEKN
HCNRYMHDQLDATLSSTASMEISQQQNPDPGLGGTVGECMDDVMDTFGYMELLEANDFFD
PASIFQNEEQHAMVHHQQGQAEEEDHQVPFCEEIQGDEEGGDGVGVDDEMSNVFLEWLKS
NKDSVSANDLRNVKLKKATLESAARRLGGGKEAMKQLLKLILEWVQTSHLQNKRRKENNG
SSISSVLQAQFQDPSGQNNNQNTQSGSFAPESNTCFNNQTPWLSSQTFATDQAPLMVPPQ
QFPQPMVGNPYQPGAEQYHMLESAHSWPHSLFNVASNYSQSFGDNNGLNPHGGFGGGGYG
NNQYPYQFFHGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRHHSGNHQNQGSDPHARM
GGDNCNTALAAPHHANPSANWMYWQAMIGGAAGPLAPVIPAEPPVVQPVVDRSAMQTQNC
HQNRVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISI
TMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIR
GVKVRQQGVKPETKKAGKSQKNQHGTGTNASSTAGTAANNGTSSSPKTKSEKSSKLI
Download sequence
Identical sequences Glyma08g47240.1|PACid:16274136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]