SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g02430.1|PACid:16274535 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g02430.1|PACid:16274535
Domain Number 1 Region: 261-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 48-189
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000102
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma09g02430.1|PACid:16274535
Sequence length 590
Sequence
MAYSAEPSSSLSFTSSSHLSNGSVSHNICPSYGSDPGPNLEAISLSKLSSNLEQLLIEPD
CDYSDADLVVEGIPVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMNDLLPYGKVG
YEAFLIFLGYVYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVS
LFQRRLLNFIGKALVEDVIPILTVAFHCQSNQLVNQCIDRVARSDLDQISIDQELPHELS
QKVKLLRRKPQQDVENDASVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANA
LHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACASDL
TFDGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLEREMRRNPMAGDACMSSHTM
ADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLREVD
LNETPIVQNKRLLSRMEALTKTVEMGRRYFPHCSEVLDKFMEDDLPDLFYLEKGTHEEQR
IKRTRFMELKDDVHKAFNKDKAEFSRSGISSSSSSSSLRDSVVHYKARKV
Download sequence
Identical sequences A0A0B2QTH6 B8XQT5
NP_001238658.1.40590 Glyma09g02430.1|PACid:16274535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]