SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g07440.1|PACid:16275090 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g07440.1|PACid:16275090
Domain Number 1 Region: 251-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-17
Family Ankyrin repeat 0.00094
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily POZ domain 0.00000000549
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma09g07440.1|PACid:16275090
Sequence length 572
Sequence
MNFRSGSSDSKDASNSSTGEAYLSGVSDVITPLRRLSEQLGSILDGGGVDFFSDAKIVAG
DGREVAVNRCILAARSGFFKHVFAGGGGCVLRLKEVAKDYNVGLEALGIVLAYLYSGRVK
PLPQGGVCVCVDDVCSHFGCRPAIDFLLQLLYASSTFQLNEDHNILIILFVPDKIIGHLL
DILEKVAIDDILVVLSVANICGIVCERLLARCTEMILKSDADITTLEKALPQHLVKQITD
KRIELDLYMPENFNFPDKHVNRIHRALDSDDVELVRLLLKEGHTTLDDAYALHYAVAYCD
VKTTTELLDLGLADVNHKNYRGYSVLHVAAMRKEPKIIVSLLTKGAQPSDLTLDGRKALQ
ISKRLTKAVDYYKSTEEGKVSCSDRLCIEILEQAERREPLLGEASLSLAMAGDDLRMKLL
YLENRVGLAKVLFPMEAKVIMDISQIDGTSEFPSTDMYCPNISDHQRTTVDLNDAPFRMK
EEHLVRLRALSRTVELGKRFFPRCSEVLNKIMDADDLTQLTCMGDDSPEDRLRKRRRYVE
LQEVLNKVFNEDKEEFDRSAMSSSSSSTSIGV
Download sequence
Identical sequences Glyma09g07440.1|PACid:16275090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]