SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma09g08350.1|PACid:16275193 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma09g08350.1|PACid:16275193
Domain Number 1 Region: 64-203
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-44
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 960-1024
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000103
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma09g08350.1|PACid:16275193
Sequence length 1073
Sequence
VAASMQKEADFIPSYPNLPSKLICMLHNVALHADPETDEVYAQMTLQPVNKYDKEALLAS
DMGLKQNQQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLH
DNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKQQLLLGIKRANRQQP
ALSSSVISSDSMHIGILAAAAHAASNNSPFTIFYNPRASPSEFVIPLAKYNKALFNQVSL
GMRFRMMFETEESGVRRYMGTITGITDLDPVRWKNSQWRNLQVGWDESTAGERPSRVSIW
DIEPVVTPFYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDLGMKDASSSVFP
GFSLMQWMSMQQNNQFSAAQSGFIPPSMLSSNALHGNLTTDDPSKLLSFQAPVLSSPNLQ
FNKPNLANQVNQLQQSPTSWSPQQQQQQQQQKLQSMLQTPLNPLQQQRQQQLPVPQNLPQ
PQQQQPQMPQQRAQQPQEQQQQSCQQTIMNNGAVASNQIPNQCVQQPVSYSQLQQQQLIS
GSIPPQQCFPSPNKNTLLMTSLPQDSQFQQQIDQQASLLQRQQLQQQQQQTQLQSSPLQL
LQQSLSQRAPQQPQMTQMSQQNSSDQQPQLQMLQKLQQQQQQQQQQQQQKPLSTSSPLLQ
SQLLQQQNTHQQNQQFPQLPLSQGHQPQQLGNNAFSMEKLLNGNNYSSSSLMQTQQLSVN
QPHNTQKSLTNTRAPSTLTDGDAPSCSTSPSTNNCQISPNLMKRNQQVSATLGGPSVVEP
TNHLMQELHSKSEMQIKHELPSVRGTDQLKFKGTVADQMEASSGTSYCIDPNNIHQNFPL
PNFCMDGDVQSHPRNNLPFASNLDGLTPDTLLSRGYDSQKDFQNLLSNYGGAPRDIETEL
STAALSPQPFGVPDMPFKPGCSSDIAINDPGVLNNGLWANQTQRMRTYTKVQKCGSVGRC
IDVTRYKGYDELRHDLARMFGIEGQLEDPQRTEWKLVYVDHENDILLVGDDPWEEFVSCV
QSIKILSSSEVQQMSLDGDLGHVPVPNQACSGTDNGNAWRGQYDDNSAASFNR
Download sequence
Identical sequences Glyma09g08350.1|PACid:16275193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]