SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma10g17480.1|PACid:16279604 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma10g17480.1|PACid:16279604
Domain Number 1 Region: 48-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000379
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma10g17480.1|PACid:16279604
Sequence length 164
Sequence
MASVCTHLTLGMCSCTPSFACSSSTKKRKLCNKANVGSRNKKLKNEDDEVWKIKKVLKES
DVGSMSRLILTREMAEKFVLPVLGDDADQIDSGVSVQIWDADTNSMHSLVFKRWVSSRSY
VFIGNWIKDFVARRGLRKGDEIGFQWNPFKNGFEFSVLQVNYMG
Download sequence
Identical sequences A0A0R0HRK3
XP_006589996.1.40590 Glyma10g17480.1|PACid:16279604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]