SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma10g34760.1|PACid:16280958 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma10g34760.1|PACid:16280958
Domain Number 1 Region: 170-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.16e-29
Family B3 DNA binding domain 0.00000843
Further Details:      
 
Domain Number 2 Region: 52-108
Classification Level Classification E-value
Superfamily DNA-binding domain 1.05e-17
Family GCC-box binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma10g34760.1|PACid:16280958
Sequence length 351
Sequence
MDGGCVTDETTTSSDSLSVPPPSRVGSVASAVVDPDGCCVSGEAESRKLPSSKYKGVVPQ
PNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDIAALRFRGPDAVTNFKPPAASDDAESEF
LNSHSKFEIVDMLRKHTYDDELQQSTRGGRRRLDADTASSGVFDAKAREQLFEKTVTPSD
VGKLNRLVIPKQHAEKHFPLSGSGDESSPCVAGASAAKGMLLNFEDVGGKVWRFRYSYWN
SSQSYVLTKGWSRFVKEKNLRAGDAVQFFKSTGPDRQLYIDCKARSGEVNNNAGGLFVPI
GPVVEPVQMVRLFGVNLLKLPVPGSDGVGKRKEMELFAFECCKKLKVIGAL
Download sequence
Identical sequences Q45EZ4
NP_001237600.1.40590 Glyma10g34760.1|PACid:16280958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]