SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g02940.1|PACid:16282484 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g02940.1|PACid:16282484
Domain Number 1 Region: 152-486,524-552
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.89e-19
Family Cystathionine synthase-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma11g02940.1|PACid:16282484
Sequence length 573
Sequence
MHLPCAGKASQPCYNGCFPSSFLASISDKSHNAPNSSHDLEAATSTTLHPHTQFTNHESL
PSLEESHINFTKAYPSFGNNTCQLVDRIRAQEYHHLNPSNICFDYTGYGLFSHAQDQKQT
ASSVASSSSSCPPPSSLPEPPFFVISYKPVSLHSQIHYGGQESELESKIRERIMAFMNIS
EADYSLVFIANEVSAFKLVADSFQFHPDGELLTVYDHKSEAVDVMIETCKEQGVHVSSAK
FCWPSLRIMSSKLKKMIMRRRGKRKRGLFVFPPYSNVTGTPYSYIWMSLAQENGWHVLLD
ARALGPKEMETLGLAMFKPEFMVCSFYKVFGENPSGFGCLFIKKSSISALKESDNATSMG
IKLKQKQDKMMDQCQHMGLKKCFHQKLWKVECRGLDHADSVGLIAISIRGKYLINWLVNA
LISLQHPHAPTGRSLIRIYGPKINSHRGTVVAFNVFDWKGEKVDPAIVQKLADRNNISLS
SAFLQNIWFSDKSDEEGQRTLESKVHRVKVLGHSNKTHSSGFGITVVKASLGLLTNFEDV
YRLWAFLSRFLDADFVEKEKWRYLALNQKTIHI
Download sequence
Identical sequences Glyma11g02940.1|PACid:16282484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]