SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g05870.1|PACid:16282832 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g05870.1|PACid:16282832
Domain Number 1 Region: 153-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000151
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma11g05870.1|PACid:16282832
Sequence length 271
Sequence
LSFYNKFFDRRFISDTKIKLFLKLIYHHLFLCLIFTDWKSLEKMSCKPFKPSILHLAISK
DAPQLYREEELIQLKNFSKLLSSVESKPKTNNTGQRMTRKRQIEEMPKEERVTPAMIKKP
RRIILVQNGPSPDLPAEFKDRVSELSGHDLKFLMHKRLFCSDVKSNSNRMSMPINEIKCE
FLTEAEITKLDERDGPNGKGRLVGVEVTVLDPCLREFTLLLKKWSMQRTDTYNLVTNWNS
IVSTNKFEEDQELQIWSFRVGSKLYLLLNKL
Download sequence
Identical sequences Glyma11g05870.1|PACid:16282832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]