SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g13210.2|PACid:16283725 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g13210.2|PACid:16283725
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-24
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-17
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma11g13210.2|PACid:16283725
Sequence length 404
Sequence
MRKYGGELSPIVTLSVPDGSVWHVGLKKADNKYCFLDGWKEFVQRYSIGVGYLLVFRYEG
KSSFNVHIFNLATSEINYQSVTRSSNEGLHFTNCLKFFEEMEGEDSIEISDSSPSHLSPS
SLQNQALAGSVDKMMPGKSYNTPPALQNLFNGSKLNSINWGEGGNAHSSRSANSLDNRLT
RDIGLQFNAVEFKRSTEELKLRASIEERMKKTTRKKRKSDGQEPSAGHEEEVEMRFRFYE
SASARKRTVTAEERERVINEAKAFEPSNPFCRVVLRPSYLYRGCIMYLPSCFAEKHLNGV
SGFIKLQISNGRQWPVRCLYKGGRAKLSQGWFEFSLENNLGEGDVCVFELLRMKEVVLQV
TIFHVTEDVGLLSPPLQHNQNMTSAKLLSTPLQQHLTSTKMVRN
Download sequence
Identical sequences A0A0R0HGC7
Glyma11g13210.2|PACid:16283725 XP_006590918.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]