SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma11g15910.1|PACid:16284061 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g15910.1|PACid:16284061
Domain Number 1 Region: 134-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-44
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 622-698
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000432
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma11g15910.1|PACid:16284061
Sequence length 747
Sequence
MEIDLNHEVTEVEKNAFCDRESLVSSSYLELWHACAGPLTSLPKKGNVVVYFPQGHLEQV
ASFSPFTPLEIPTYDLQPQIFCRVVNVQLLANKENDEVYTQVTLLPQAELEGMYLEGKEL
EELGAEEEGDDRSPTKSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYKQQRPSQ
ELVAKDLHDVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRGENGELRLGI
RRAVRPRNDLPESVIGSQNCYPNVLSSVANAISTKSKFHVFYSPRASQADFVVPYQKYVK
SIKNPVSIGTRFKMRFEMDESQERRCCSGMLIGTSDLDPYRWPKSKWRCLMVRWDEDIET
NHKDRVSPWEIDPSAPLPPLSIQSSPRLKKLRTGLQKFIQDLSKESARGRGLIDFEESVR
SPKVLQGQENAGFGSLYYGCDTVTKPPGFEMSSQSHPNLGSAEVRKITSSELSSVHPFSY
AGFVETNRFPRVLQGQEICPLKSLTGKATKPSFQLSLFPYGDIHQASQASLFCSKSTTFQ
RENVPFNKPSTQAGIIVNEVGRSDLPNDHKLQGNNISAAGNMGVSIDNNVQGKVNACKLF
GFSLSGETTTQNLQNSAKRSCTKVHKQGSLVGRAIDLSRLSGYNDLLSELERLFSMEGLL
KDPDKGWKILYTDSENDIMVVGDDPWHEFCDVVSKIHIYTQEEVEKMTIEMISDDTHSCL
EEAPVIMEASKSSSVGQPDYSPTAVRV
Download sequence
Identical sequences Glyma11g15910.1|PACid:16284061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]