SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g07560.1|PACid:16286759 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g07560.1|PACid:16286759
Domain Number 1 Region: 158-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-44
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 651-727
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000422
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g07560.1|PACid:16286759
Sequence length 776
Sequence
MEIDLNHEVTEAEKNAFCDRECEKGAGAGAGITCWSSSTCSSSSAACVSSSYLELWHACA
GPLTSLLKKGNVVVYFPQGHLEQVASFSPFTPLEIPTYDLQPQIFCRVVNVQLLANKEND
EVYTQVTLLPQPELEGMYSEGKELEELGAEEDGDERSPTKSTPHMFCKTLTASDTSTHGG
FSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVS
QKNLVSGDAVLFLRGENGELRLGIRRAVRPRNDLPESVIGSQNCYSNVLSSVANAISTKS
KFHVFYSPRASHADFVVPYQKYVKSIKNPVSIGTRFKMRFEMDESQERRCSSGTLIATSD
LDPYRWAKSKWRCLMVRWDEDIETNHQDRVSPWEIDPSAPLPPLSIQSSPRLKKLRTGLQ
IKFSINTCKIHRSSRRTRGSGLVGFEESVRSPKVLQGQENAGFVSFYYGCDTVTKPPGFE
MSSPSHPNLGSAEVRKVSSSELNSVHPFSYAGFVETNRFPRVLQGQEICSLKSLTGKATK
PNFQPSLFPYGDIHQAGQASLFCSKSTTFQRENVPFNKPSTQAGIIVNEVGRSDLPNEHK
LQDNISSAANMGVSNDNNVQGKVNACKLFGFSLSGETTAQNLQNSAKRSCTKVHKQGSLV
GRAIDLSRLSGYNDLLSELERLFSMEGLLKDPDKGWRILYTDSENDIMVVGDDPWHEFCD
VVSKIHIYTQEEVEKMTIGMISDDTHSCLEEAPVIMEASKSSSVGQPDYSPTAVRV
Download sequence
Identical sequences Glyma12g07560.1|PACid:16286759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]