SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g08110.1|PACid:16286827 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g08110.1|PACid:16286827
Domain Number 1 Region: 105-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.5e-30
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g08110.1|PACid:16286827
Sequence length 701
Sequence
MKEGEKVLDPQLWHACAGGMVQMPQMNSKVFYFPQGHAEHAHTNIHLRLPPFILCNVEAV
KFMANPETDEVFAKLSLLPLRNSELGADSDGAGGDDVAEPSCCEKPASFAKTLTQSDANN
GGGFSVPRYCAETIFPRLDYTAEPPVQTVVAKDVHGETWRFRHIYRGTPRRHLLTTGWSS
FVNQKKLVAGDSVVFLRAENGDLCVGIRRAKKGISEGSGSGSSSVWSSASGSGNGNCGIG
PYGPFSFFLKEENKMLRNGCGGNLSGRVKVRAEDVVEAVTLAASNKPFEVVYYPRASTPE
FCVKASAVRAAMRIQWCSGMRFKMAFETEDASRISWFMGTIASVQVVDPIRWPNSPWRLL
QVTWDEPDLLQNVKRVSPWLVELVSNIPLINFTPFSPPRKKLRPQHPDFPLDVQFPIPMF
SGNQLGPNSPLCGFSDNAPAGIQGARHAQFGKSLSDLHLNNKLQLGMLPTNIHQLGVYNE
ISNGNMMTNHDKSKESLSCFLTMGKSTKSLEKSDDVKKHQFLLFGQPILTEQQISSCSGD
VLSHRKRSVSDDKDKAKCLMDDSQSTLSQQFSPGKASSAEFSWQLGLDTGHCKVFLESED
VGRTLDLSLFGSYEDLYRRLAIMFGIERSEILNHVLYHDAAGAAKKTGEEPFSDFMKTAK
RLTILTDSSSKNIKRAFITGTRNGEHGLDASNKTGPLSIFA
Download sequence
Identical sequences I1LR43
XP_003539766.1.40590 Glyma12g08110.1|PACid:16286827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]