SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g29170.1|PACid:16288261 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g29170.1|PACid:16288261
Domain Number 1 Region: 98-499
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.14e-156
Family GABA-aminotransferase-like 0.00000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma12g29170.1|PACid:16288261
Sequence length 605
Sequence
MDLSHPQSNLSLGFSSSHASPPPRSDPPVPLQLMEPQTENGNLDVESDDDEDKEVEEFRI
LGHSMCLKRRRDCDSSSSSSAAKRVSVEPDLDARKAAVRAWGCQPLSIADPDVHEIMEKE
KKRQFRGIELIASENFVCRAVMEALGSHLTNKYSEGMPGARYYGGNQYIDEIETLCCERA
LNAFGLDPKCWGVNVQPYSCTSANFAVYTGLLLPGDRIMGLDTPSGGNTSHGYYTPNGKK
VSGASIFFESLPYKVNPQTGYIDYDKLEERALDFRPKILICGGSSYPREWDYARFRHIAD
KCGAVLLCDMAQISGIIAAKECVNPFDYCDIVTSTTHKSLRGPRGGIIFYRKGTKPRKRG
ILLSQGHESDQYDFEEKINFAVFPSMQGGPHNNHIAALAIALKQVATPEYKAYMQQVKKN
AQALACALLRRKCRLVTGGTDNHLILWDLRPLGLTGKFYEKVCETCHITLNKIAIFGDNG
TIIPGGVRVGTPAMTSRGLAGELPLLIIYICDNGVSLCPLFTKAHLVLIFCGASLFSALY
AVVRFSHLAVSCNLVQDSIYLLKPLKLGLDRGIILGIKPFISLANIFLLLFPKYIIQFSF
FSIIG
Download sequence
Identical sequences Glyma12g29170.1|PACid:16288261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]