SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g29280.2|PACid:16288274 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g29280.2|PACid:16288274
Domain Number 1 Region: 21-142
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-44
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 533-611
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000027
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g29280.2|PACid:16288274
Sequence length 660
Sequence
MYMEGKELEKLGADEEGNETTPTKSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLD
YKKQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRGE
NGELRLGIRRAARPRNGLPESIVGSQSYYPNFLSSVANAISAKSMFHVFYSPRASHADFA
VPYQKYIKSIKNPVTIGTRFKMKFEMDESPERRCTSGIVTGMSDLDPYKWPKSKWRCLMV
RWDEDIEINHQDRVSPWEVDPSASLPPLSIQSSRRLKKLRPGLLAAAPNHLTTGSSGFMD
SEESVRSSKVLQGQENTGFMSLYYGCDTVTKQPEFEIRSPSHPNLASTGVRKIAAAEFMR
VHPSSYAGFTETNMFPRVLQGQEICPFRSLAGKVDLNFGSWGKPNVSYTNYNLHQATKPN
FHSFGPEVVQTAYFPYGDIHKAGQGSSMLCSNPTNFQREDIPFNTPSIQSGITIPNEQKL
QDNISGAASLGANMRIPNDDNFKGKVNACKLFGFPLSRETTAQNLQNSSKRSCTKVHKQG
SLVGRAIDLSRLSSYNDLLIELERLFSMEGLLIDPNKGWRILYTDSENDIMVVGDDPWHE
FCDVVSKIHIHTQEEVEKMTIGMMINDDSQSCLEQAPVMVEASKSSSVGQPDSSPTVVRM
Download sequence
Identical sequences Glyma12g29280.2|PACid:16288274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]