SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma12g29280.3|PACid:16288275 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g29280.3|PACid:16288275
Domain Number 1 Region: 153-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-44
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 665-743
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000348
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g29280.3|PACid:16288275
Sequence length 792
Sequence
MEIDLNDAVTSEAEKSASCNGECEKGAALSSPTCSSSGSSSTRVSSSYIELWHACAGPLT
SLPKKGNVVVYFPQGHLEQAASFSPFSPMEMPTYDLQPQIFCRVVNIQLLANKENDEVYT
QVTLLPQAELAGMYMEGKELEKLGADEEGNETTPTKSTPHMFCKTLTASDTSTHGGFSVP
RRAAEDCFPPLDYKKQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNL
VSGDAVLFLRGENGELRLGIRRAARPRNGLPESIVGSQSYYPNFLSSVANAISAKSMFHV
FYSPRASHADFAVPYQKYIKSIKNPVTIGTRFKMKFEMDESPERRCTSGIVTGMSDLDPY
KWPKSKWRCLMVRWDEDIEINHQDRVSPWEVDPSASLPPLSIQSSRRLKKLRPGLLAAAP
NHLTTGSSGFMDSEESVRSSKVLQGQENTGFMSLYYGCDTVTKQPEFEIRSPSHPNLAST
GVRKIAAAEFMRVHPSSYAGFTETNMFPRVLQGQEICPFRSLAGKVDLNFGSWGKPNVSY
TNYNLHQATKPNFHSFGPEVVQTAYFPYGDIHKAGQGSSMLCSNPTNFQREDIPFNTPSI
QSGITIPNEQKLQDNISGAASLGANMRIPNDDNFKGKVNACKLFGFPLSRETTAQNLQNS
SKRSCTKVHKQGSLVGRAIDLSRLSSYNDLLIELERLFSMEGLLIDPNKGWRILYTDSEN
DIMVVGDDPWHEFCDVVSKIHIHTQEEVEKMTIGMMINDDSQSCLEQAPVMVEASKSSSV
GQPDSSPTVVRM
Download sequence
Identical sequences I1LTG6
Glyma12g29280.3|PACid:16288275 XP_006592682.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]